Handbuch für Frischsäfte, Rohkost und Früchtespeisen

Über neueste biophysikalische-wissenschaftliche Erkenntnisse zur Lebensenergie, Nahrungsenergie, Wirkung der lebendigen, vegetarischen Frischkost, Bircher-Benner-Handbuch 4

Bircher, Andres/Bircher, Lilli/Bircher, Anne-Cécile u a

78 Seiten

49,80 €
Inkl. 7% Steuern

Lieferzeit: 5 Werktage(inkl . Versand)

Einleitung Viele Diätformen kommen eine Zeitlang auf, um dann wieder zu verschwinden. Die vitale vegetabile Frischkostdiät die Sie in diesem Handbuch kennen lernen werden, basiert dagegen auf solider wissenschaftliche Grundlage, die sich in den letzten 100 Jahren nur bestätigt und vertieft hat. Am Ende des 19. Jahrhunderts entdeckte Dr.med. Maximilian Bircher-Benner, entgegen all seinen Erwartungen, fast zufällig die hohe Wirksamkeit ganz frisch zubereiteter, lebendiger Vegetabilien, wenn es um die Verhütung und Heilung der heute immer häufiger und immer früher auftretenden chronischen Krankheiten geht. Nach mehreren Jahren klinischer Erforschung, erkannte er, dass die lebendigen Vegetabilien eine ganz andere Nahrungsenergie enthalten müssen als die Verbrennungswärme (Kalorien). Bereits 1905 veröffentlichte er in Berlin seine erste, viel beachtete Ernährungslehre, nachdem er erkannt hatte, dass die Kalorien, das Mass der Wärmeenergie, die durch Verbrennung der Nahrungsmittel bestimmt wurde, zum Verständnis der Nahrungsenergie nicht ausreichen. Die erstaunliche, heilende Wirkung seiner Diät erklärte er auf Grund seiner wissenschaftlicher Nachforschungen über mehrere Jahre mit dem zweiten Hauptsatz der Thermodynamik, dem Entropiegesetz. In der Tat ist es erstaunlich, dass unsere moderne medizinische Wissenschaft auch heute noch immer als einziges Mass für die Nahrungsenergie die Kalorien, die Verbrennungswärme kennt, während der zweite Hauptsatz der Thermodynamik auf allen anderen wissenschaftlichen Gebieten, in der Technik, der Physik und der Chemie seit 150 Jahren zur Basis aller energetischen Betrachtungen geworden ist. Am Anfang des 20 Jahrhunderts, beherrschte die Furcht vor Ansteckung durch Bakterien die medizinische Welt, so dass man glaubte, es sei besser, alle Nahrung vor dem Verzehr zu kochen. Daraus ergaben sich neue Forderungen hygienischer Zubereitung der Rohkost. Als dann hitzelabile Vitamine und Vitalstoffe entdeckt wurden, bahnte sich Bircher-Benners Rohkostdiät ihren Weg zu weltweiter Anerkennung. Die Erforschung der LASER-Amplifikation der Photonen in der Erbsubstanz der lebendigen Zellen ,5,6, und der Informationsleitung und -speicherung in der Grundsubstanz des Bindegewebes bestätigen Bircher-Benners Hypothese der Lichtakkumulation in lebendigen Nahrungsmitteln und der enormen Bedeutung der Photosynthese für den Energiewert der Nahrungsmittel als ordnende und damit heilende Information. Eine weitere Bestätigung aus der Grundlagenforschung brachten unter anderem die Arbeiten des Nobelpreisträgers Ilya Prigogine über das dissipative System der lebenden Zellen, welche zeigten, dass das Streben aller physikalischen Vorgänge nach Unordnung (Entropiegesetz) in den lebendigen Zellen nicht gilt, da sie durch die Speicherung der Photonen aus der Photosynthese und die enorme rhythmische Verstärkung dieses Lichtes in den Zellen nach dem LASER-Prinzip in ihrer Energie so weit vom thermodynamischen Gleichgewicht entfernt werden, dass der zweite Hauptsatz der Energetik nicht gilt und das Chaosprinzip in ein ordnendes Kohärenzprinzip umschlägt. In der Tat sind alle lebendigen Zellen der Natur der einzige Ort, wo aus kleinen, einfachen Molekülen komplexe, hochgeordnete Moleküle, Abläufe und Strukturen entstehen: wo aus Chaos Ordnung wird. Dies ist die grosse Bedeutung der Rohkostdiät, als einzige Diät, welche das ordnende Prinzip und die Ordnende Wirkung der lebendigen Zellen auf unser biologisches System überträgt und damit ihre grosse ordnende Heilwirkung entfaltet. Hinzu kommt die hohe Nahrungsökonomie der lebendigen Pflanzennahrung, in welcher alle Nahrungsstoffe in geeigneten Mengenverhältnissen organisch gebunden und dadurch biologisch in höchstem Masse verfügbar werden, und wo die für die Assimilation der Vitalstoffe notwendigen Enzyme zugleich mitgeliefert sind, ihr hoher Gehalt an Polyphenolen, Carotinen und anderen Antioxidantien mit ihrer grossen, vor Degeneration und vor Genmutationen

Handbuch für Frischsäfte, Rohkost und Früchtespeisen Diesem Handbuch liegt das Wissen und die jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute Medizinisches Zentrum Bircher-Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht ihm den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohlschmeckenden, erprobten, abwechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.

Über den Autor: Dr.med. Andres Bircher ist Enkel von Dr.med. Maximilian Bircher-Benner. Nach dem Medizinstudium in Zürich und Genf, zehnjährige Tätigkeit als Spitalarzt in Anästhesiologie, Intensivmedizin, Rettungswesen, Chirurgie, Kinderheilkunde, Psychosomatik, Hämatologie, Geriatrie, Psychiatrie und Psychotherapie, als Facharzt an Zürcher Universitätskliniken in leitender Position. Lehranalyse bei Brian Kenny. Chefarzt einer Klinik für Innere Medizin in Zürich und später in der Westschweiz, Studium und Facharztausbildung in TCM und Akupunktur in Wien, Neuraltherapie, Manualtherapie, klassische Homöopathie, Ausbildung zum deutschen Facharzt in Balneologie, Klimatologie und physikalische Medizin. Wissenschaftliche Arbeiten über die Nahrungsenergie, Diätetik und die Wirkungen der regulativen Medizin. Ärztlicher Leiter des medizinischen Zentrums Bircher-Benner

Mehr Informationen
Autor Bircher, Andres/Bircher, Lilli/Bircher, Anne-Cécile u a
Verlag Edition Bircher-Benner
ISBN 9782970072232
ISBN/EAN 9782970072232
Lieferzeit 5 Werktage(inkl . Versand)
Lieferbarkeitsdatum 07.09.2020
Einband Kartoniert
Format 0.6 x 21 x 15.2
Seitenzahl 78 S.
Gewicht 163

Weitere Informationen

Mehr Informationen
Verlag Edition Bircher-Benner
ISBN 9782970072232
Format 0.6 x 21 x 15.2
Gewicht 163

Einleitung Viele Diätformen kommen eine Zeitlang auf, um dann wieder zu verschwinden. Die vitale vegetabile Frischkostdiät die Sie in diesem Handbuch kennen lernen werden, basiert dagegen auf solider wissenschaftliche Grundlage, die sich in den letzten 100 Jahren nur bestätigt und vertieft hat. Am Ende des 19. Jahrhunderts entdeckte Dr.med. Maximilian Bircher-Benner, entgegen all seinen Erwartungen, fast zufällig die hohe Wirksamkeit ganz frisch zubereiteter, lebendiger Vegetabilien, wenn es um die Verhütung und Heilung der heute immer häufiger und immer früher auftretenden chronischen Krankheiten geht. Nach mehreren Jahren klinischer Erforschung, erkannte er, dass die lebendigen Vegetabilien eine ganz andere Nahrungsenergie enthalten müssen als die Verbrennungswärme (Kalorien). Bereits 1905 veröffentlichte er in Berlin seine erste, viel beachtete Ernährungslehre, nachdem er erkannt hatte, dass die Kalorien, das Mass der Wärmeenergie, die durch Verbrennung der Nahrungsmittel bestimmt wurde, zum Verständnis der Nahrungsenergie nicht ausreichen. Die erstaunliche, heilende Wirkung seiner Diät erklärte er auf Grund seiner wissenschaftlicher Nachforschungen über mehrere Jahre mit dem zweiten Hauptsatz der Thermodynamik, dem Entropiegesetz. In der Tat ist es erstaunlich, dass unsere moderne medizinische Wissenschaft auch heute noch immer als einziges Mass für die Nahrungsenergie die Kalorien, die Verbrennungswärme kennt, während der zweite Hauptsatz der Thermodynamik auf allen anderen wissenschaftlichen Gebieten, in der Technik, der Physik und der Chemie seit 150 Jahren zur Basis aller energetischen Betrachtungen geworden ist. Am Anfang des 20 Jahrhunderts, beherrschte die Furcht vor Ansteckung durch Bakterien die medizinische Welt, so dass man glaubte, es sei besser, alle Nahrung vor dem Verzehr zu kochen. Daraus ergaben sich neue Forderungen hygienischer Zubereitung der Rohkost. Als dann hitzelabile Vitamine und Vitalstoffe entdeckt wurden, bahnte sich Bircher-Benners Rohkostdiät ihren Weg zu weltweiter Anerkennung. Die Erforschung der LASER-Amplifikation der Photonen in der Erbsubstanz der lebendigen Zellen ,5,6, und der Informationsleitung und -speicherung in der Grundsubstanz des Bindegewebes bestätigen Bircher-Benners Hypothese der Lichtakkumulation in lebendigen Nahrungsmitteln und der enormen Bedeutung der Photosynthese für den Energiewert der Nahrungsmittel als ordnende und damit heilende Information. Eine weitere Bestätigung aus der Grundlagenforschung brachten unter anderem die Arbeiten des Nobelpreisträgers Ilya Prigogine über das dissipative System der lebenden Zellen, welche zeigten, dass das Streben aller physikalischen Vorgänge nach Unordnung (Entropiegesetz) in den lebendigen Zellen nicht gilt, da sie durch die Speicherung der Photonen aus der Photosynthese und die enorme rhythmische Verstärkung dieses Lichtes in den Zellen nach dem LASER-Prinzip in ihrer Energie so weit vom thermodynamischen Gleichgewicht entfernt werden, dass der zweite Hauptsatz der Energetik nicht gilt und das Chaosprinzip in ein ordnendes Kohärenzprinzip umschlägt. In der Tat sind alle lebendigen Zellen der Natur der einzige Ort, wo aus kleinen, einfachen Molekülen komplexe, hochgeordnete Moleküle, Abläufe und Strukturen entstehen: wo aus Chaos Ordnung wird. Dies ist die grosse Bedeutung der Rohkostdiät, als einzige Diät, welche das ordnende Prinzip und die Ordnende Wirkung der lebendigen Zellen auf unser biologisches System überträgt und damit ihre grosse ordnende Heilwirkung entfaltet. Hinzu kommt die hohe Nahrungsökonomie der lebendigen Pflanzennahrung, in welcher alle Nahrungsstoffe in geeigneten Mengenverhältnissen organisch gebunden und dadurch biologisch in höchstem Masse verfügbar werden, und wo die für die Assimilation der Vitalstoffe notwendigen Enzyme zugleich mitgeliefert sind, ihr hoher Gehalt an Polyphenolen, Carotinen und anderen Antioxidantien mit ihrer grossen, vor Degeneration und vor Genmutationen

Handbuch für Frischsäfte, Rohkost und Früchtespeisen Diesem Handbuch liegt das Wissen und die jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute Medizinisches Zentrum Bircher-Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht ihm den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohlschmeckenden, erprobten, abwechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.

Über den Autor: Dr.med. Andres Bircher ist Enkel von Dr.med. Maximilian Bircher-Benner. Nach dem Medizinstudium in Zürich und Genf, zehnjährige Tätigkeit als Spitalarzt in Anästhesiologie, Intensivmedizin, Rettungswesen, Chirurgie, Kinderheilkunde, Psychosomatik, Hämatologie, Geriatrie, Psychiatrie und Psychotherapie, als Facharzt an Zürcher Universitätskliniken in leitender Position. Lehranalyse bei Brian Kenny. Chefarzt einer Klinik für Innere Medizin in Zürich und später in der Westschweiz, Studium und Facharztausbildung in TCM und Akupunktur in Wien, Neuraltherapie, Manualtherapie, klassische Homöopathie, Ausbildung zum deutschen Facharzt in Balneologie, Klimatologie und physikalische Medizin. Wissenschaftliche Arbeiten über die Nahrungsenergie, Diätetik und die Wirkungen der regulativen Medizin. Ärztlicher Leiter des medizinischen Zentrums Bircher-Benner

 

Kategorie